PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN46464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 347aa    MW: 38928.6 Da    PI: 6.0798
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN46464.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.77.3e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lvd+++++G g+W++ +++ g++R++k+c++rw +yl
       KHN46464.1 14 KGPWTPEEDRILVDYIQKHGHGSWRALPKHAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.85e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++l++++++ lG++ W++Ia +++ gRt++++k++w+++l
       KHN46464.1  67 RGKFSEEEEQLIINLHAVLGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.347961IPR017930Myb domain
SuperFamilySSF466891.8E-3211108IPR009057Homeodomain-like
SMARTSM007171.2E-161363IPR001005SANT/Myb domain
PfamPF002493.2E-181461IPR001005SANT/Myb domain
CDDcd001672.25E-131661No hitNo description
PROSITE profilePS5129427.68562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2865116IPR009057Homeodomain-like
SMARTSM007174.0E-1766114IPR001005SANT/Myb domain
PfamPF002499.6E-1767112IPR001005SANT/Myb domain
CDDcd001674.46E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRTPCSDEN GLKKGPWTPE EDRILVDYIQ KHGHGSWRAL PKHAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQLIIN LHAVLGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLLQMG  120
LDPVTHRPRS DHLNLLSNLQ QLLAATNIVS NLTNTWDTNN ALRLQSDATQ LAKLQLLQNI  180
LHVLGDTTPT SNLDLLNPFG PSSSSLPDGF LNEVLGLNQS KLQNLYNGYS AQNQPNLQSF  240
EPPHQQQVLP TGNQHMDGGS IDSSCMKPEK GDEQLDVPYS SSTPFNSLPN LVSASPECST  300
HVLMQMENKV MPNECSDPSS STSTNFEMWG DFMYEEVSDA YWKDLIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1086510.0AB108651.1 Glycine max MYB101 mRNA for transcription factor MYB101, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592013.20.0PREDICTED: transcription factor MYB39
TrEMBLA0A0B2SPH30.0A0A0B2SPH3_GLYSO; Transcription factor MYB39
TrEMBLI1LP670.0I1LP67_SOYBN; Uncharacterized protein
STRINGGLYMA12G01960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-100myb domain protein 9
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]